SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H6MY53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H6MY53
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-23
Family Caspase recruitment domain, CARD 0.0000242
Further Details:      
 
Domain Number 2 Region: 112-185
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-17
Family DEATH domain, DD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H6MY53
Sequence length 198
Comment (tr|A0A2H6MY53|A0A2H6MY53_MICLE) Uncharacterized protein {ECO:0000313|EMBL:LAA20221.1} OX=129465 OS=Micrurus lemniscatus carvalhoi. GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MDARDKQVLRSLRLELCAELLVEGLIIQYLYQEEILTDNHVQEIKAQVTNQRKTLVLLDI
LPTRGPKAFEAFLESLQEFPWVREKLESKRNEVMLMTSIDDQLLRFPQKILKKSPTDQQI
SKLAQRLGPEWECIVLFLGLSQNDIYCCKVNHPYNIKSQIVSAFILWRQRLGNKATVESL
CTGLKFGEVDSSVIQQLF
Download sequence
Identical sequences A0A2H6MY53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]