SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H9MR95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2H9MR95
Domain Number - Region: 8-47
Classification Level Classification E-value
Superfamily RING/U-box 0.00152
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H9MR95
Sequence length 59
Comment (tr|A0A2H9MR95|A0A2H9MR95_9ARCH) 30S ribosomal protein S14 {ECO:0000313|EMBL:PIW32203.1} KW=Complete proteome OX=2022694 OS=Nitrosopumilales archaeon CG15_BIG_FIL_POST_REV_8_21_14_020_37_12. GN=COW27_05000 OC=Archaea; Thaumarchaeota; Nitrosopumilales.
Sequence
MAKDRSYEFTGRKKHDFGRGSRWCKRCGDYTAVIQKYDLMICRRCFREVATSLGFRKNR
Download sequence
Identical sequences A0A2H9MR95 A9A5I1
436308.Nmar_0796 gi|161528304|ref|YP_001582130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]