SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H9TG87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H9TG87
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000889
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H9TG87
Sequence length 545
Comment (tr|A0A2H9TG87|A0A2H9TG87_9FUNG) Ankyrin repeat {ECO:0000313|EMBL:PJF16797.1} OX=1246581 OS=Paramicrosporidium saccamoebae. GN=PSACC_03377 OC=Eukaryota; Fungi; Cryptomycota; Paramicrosporidium.
Sequence
MATAKGHLDIVEWFWENNKSVPTIHQLVFQGLFKTADWLHSKSDGKYPDQNAINEAIEQG
RCHVLKWISGKNARIFPKEQHILRAILHGYEGSLFWILKNSPKRLFSPTIFDSLASSGHW
AFIENMLGLNIIWKPSQSNVDIVVRSGRVTTLVKLLKIPQLLRPSNDSINAVARFGHVES
LHLIHEHFSDALPDARTIAALYTSGQLEVIRFLYAVVPNFKTTRVEMNAAANNGHVKVLE
YCHSRNLGLLPKKHIATTTDHVHVRIWYKRAKASMGASRTRRRAKTEAEPIQKEQPSSTQ
LQHDNPSFGELNSDDKAVSAIVAKDVGLQRVQRKNTLSSIKCGQEPLPEVTLTEQPFTSS
TEVPNLNQDALNRWQKRLTEIEGCTFVSPPLPVHPEAPVVLGSQLFGYNPTATNAGHLQP
RSGPVASLGNFINNQRVPTTIPPTQTRVYSANRLPGQSGSNTKVPPMTPPPTKIDLATQL
QGRQFSVPKIAYESPMATSPYVHIPDSRNGAERTEHQPSSRPAKRQRLESSSQQSSPTAF
YHDSS
Download sequence
Identical sequences A0A2H9TG87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]