SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0BPK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0BPK7
Domain Number 1 Region: 92-410,439-455,497-517
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-84
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 886-1221,1281-1299
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-80
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1712-1731,1758-1807,1845-1920,1949-2129
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.68e-74
Family Duffy binding domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1305-1681
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-72
Family Duffy binding domain 0.0000582
Further Details:      
 
Domain Number 5 Region: 3141-3403
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-58
Family Duffy binding domain 0.000094
Further Details:      
 
Domain Number 6 Region: 2812-3071
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-53
Family Duffy binding domain 0.0000972
Further Details:      
 
Domain Number 7 Region: 2443-2763
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.89e-46
Family Duffy binding domain 0.00035
Further Details:      
 
Domain Number 8 Region: 508-754
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.14e-32
Family Duffy binding domain 0.0023
Further Details:      
 
Domain Number 9 Region: 2148-2364
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-24
Family Duffy binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I0BPK7
Sequence length 3954
Comment (tr|A0A2I0BPK7|A0A2I0BPK7_PLAFO) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:PKC42777.1} KW=Complete proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=CK202_5121 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGPPGGSGGSTLDESVKDLFDRIGKEVHDQVEKEANQYKEALKGDLSSATFPTGRRHEKP
QSESCKLNYIYDTNVTSGGGKENPCYGRQGVRFSDTKGAKCYSYKIEDNDSSIGFCAPYR
RLHLCVQNLEQIKPDQITSTHNLLVDVLLAAKYEGQSITQDYPKYQATYDDSPSKMCTML
ARSFADIGDIVRGKDLFLGTNEEKKPLEENLKEIFKKIYENLGIQEKNHYNDTPDYYKLR
EDWWIANRDQVWKAITCNAGGYSYFRKTCGGDNEKNSTLASNKCRCKDEKGEHDTDQVPT
YFDYVPQYLRWFEEWAEDFCRKKKIKVENVKKSCRGEDKESKDRYCSRNGYDCEKTKRAI
GKLRYGKQCISCLYGCNPYVDWIEKQKEQFDKQKKIYDKEIKKYENGASSSSRKTRAAST
TNYEEYEKKFYEELNKSEYSDVNAFLEKLSKEDVCTKVQDDKGGRISFENVKSSSASGGA
AGTSSTSGGGTSGDSGTNNENEGTFYRSKYCQPCPPCGVERNVNDWKEKHKIQECKSINL
YKPNEYAKPTNITILKSGEGHEDIETKLKAFCDKKDGTGSGDCGGNSDPSLCEPWQCYEE
KDIEKHGDVDDDDADGNPLNAGGLCILKNEKHVSETNSQIEPDQFQKTFHDFFYYWVAHM
LKDSIHWKKKLQRCLEKKNGNTCKKNNCKDNCGCFEKWVAQKKEQEWDPIKQQFRKQDFG
KQELILGQIRYDYVLDELLKKDELLTSIKEGYGDANEIKHIKALLEDEENEETQEEETAG
ADNQKKNTIDWLIQHEEDDAELCLEIHEDEEEGGGNDECDDDHEEEVYVSNPCATPSGSY
PSLANKVAQLMHHKAKTQLAIRAGRSLLRANASKGEYKHEGNPDDFKKEKLCEITAKHSN
DSRRDGEPCKGKDGNNERFKIGTEWKIGEKVETSYKDVFLPPRRQHMCTSNLENLDVDSV
TENDKASHSLLGDVQLAAKTDAAEIIKRYKDQNNIQLTDPIQQKDQEAMCRAIRYSFADL
GDIIRGRDMWNKDSGSTEMEKHLISIFEKINEKLPEKEQKKYSNDGKYLDLRKDWWEANR
YKVWKAMKCATKNSKIPCSGIPIEDYIPQRLRWMTEWAEWFCKEQSQAYETLQDQCGKCT
GPNKDNCTRDNNDCNTCTKACEEYEQKIKKWADQWKVISKKYEELYLQAKTAFARTAFPD
DDPDYQQVVEFFKELQKEINRSASQRSKRSIDVTNTDPTLTSPYSSAAGYIHQEIGNVGC
NVQTQFCEKKNGVIPTTGSGTNNKNYAFKNTPKDHDEACECESRPQVPPKKKEDEEDVCE
KVKGLLKGKDGETTEINGCKPKGNGNTWNCSNQIDDSHKGACMPPRRQSLCIHNLKESNE
TGTEQQLREAFINCAAIETFWLWYKYKKDKNVDAEKKLEQGEIPSEFLRSMIYTFGDYRD
LCLNTDISAKKDPIKIVKNNIQKVFNRNNGPHKEGDKEKRKKFWETNKNDIWQGMLCALE
KIANNKKTLTETYNYSLVKFSGNNSTTLEDFAKTPQFLRWFTEWGDDFCQQQKEQLVTLQ
EACPNGICEQSEEEKKKCKSACEKYQAFIEKWKGYYDKQSKKYFYDISTGMYKDNSSAKD
DVTVSSYAYEYLNKSLKKLCPDGSCSCMEQRSQQHNEDSSDALETHNSIMPQSLDKEPKE
VKGRCKCPDPPKPCDIVKDLFENKDDNKFTEACSTKYKNGKEKYTQWKCINDSSNTTRSS
PPAPVASSTLSTSPEAGASATCIPPRRQQMYIQPLQSLSGNESQVELRRIFIEMAAIETF
FQWHKFKKEKVREIKEKDEIDGKISLFGQDDTSIEENLQKQLKNGTIPDDFKRQMFYTFG
DYKDILFGKYIGIDMGTVKTNIGRVFNNGGNKSDEEREKWWKNHGPSIWNGMLCGLSYDT
KTKHNIQGVYTQLTDPSKNNMYEKVTFPSKTGPSVNTKLEQFARRPTYFRWLEEWGEEFC
KKRTDKLKKLEKECRGVNYSGYNKYCSGDGYHCDDEKGTYNSINANLNCRDCMKECRNYK
TWIVKKKNEYDKQKSKYVNEHENVISFLNKQSYKQLYENIKPYSSAADFFTSLNHCKPDK
ANDDKNNKLNFKNPHETFSPSTYCKACPLNGVICRGRSQCAANSENNLTNLGESTDFDIL
INDAAIHDNDNEIKKGCPTYEMYKDLRKQKWICQKKTGEVHQCKLNNAADSKYYDNKFPF
NILFHRWITDFIQYYNKSKEKIKPCTNDVNSCKQGCKGNCDCVDKWLKNKSTEWEIIKKY
YKENFGNTNEHIAYAIKIFLQEGLFDSDYKRAQEVIDQNEWEQLWGCTGDNLKDVKDQKA
ENCNKGDFITNLISKLQDKITSCQNKHNPNGKTACDEIPPHSDEEETSLLDDDTSTQEKM
SPDFCPSDMPEKPKTDSDILCDDKKEPKCGNFRTLFKTSTSKTKTNLIGLEAHNHRAGRF
YPNVYISPRAHQLYLEPLKDLKENNTDKNELIKAFTKCAYNEGKCLYEYYSKNKATLGKN
GSALSNDEVKTYTLEAMERSYADYGTIVKEDILWDYEDKKKIDPKIMNFAKNHNISTTKT
IVSSLDDDDVKRQKLWESIRIDVWKAMICGYKDAIGGDMNSLPNDVDLCTLPTTDDEYSF
LRWFVEWGQNFCIRHEKELKQLNEECARGTCDGTDEEKKKKCEKACKNYREFLNNFKKQY
ENQKKEYEIIKSSYPKYEKKDAFTFLKDKCNSNYSCFENKTEISVLKMFEHPPDDVKDEC
DCKTSKAHDDKVNDLDKCPNNINNNKNICNKYKKRRICGDLKYSNSLDHWFGTNTLIPPR
RRHLCLRNIIIKKNYRKGDISKFKDDLFYAAASEAKFLFNNYENKNESLQAIKYTFADIG
DIIKGNDMMDDMTYKKIKGKLEKVLDKTGNNPETPEKWWEQNKKHVWEAMLCGYKLAGGE
IKPNDCNIPTEESTHQFLRWLTEWGTQYCKEKQQLKLNMQIPCMTHFDKYGIIENRIDVH
PNCLQGLGKYEIWSNNRIPDWERLSSKFNEVKGTMNENVKKLTAYEYLKQNCSKCICSFK
DIEQTHKKSKDEGYHIYEDILDKAQIPSFLEDTAYRYKGLNPECPEDIECSQYGNIPCRG
VSHDDDNDWNSSFVKDNKTTNLGVLVPPRRRHLCLRIDVNKFLRLRNDINNLKTFICKSA
FAEAKRLKKVYKDDNSKLHQAMKYSFSDIGSVVKGNDMMESPTSDNIAKIFRGMKYTEIN
RETWWDLNKYHVWESMLCGYREAGGDTKKSENCRFPDIERVPQFLRWFQEWTEIFCIKRK
TLYDKMVTECQKAECDTSNGTVKETKCTKACEEYKSYVLSKKKEYYIQKDKYDNQFKKVL
NNKDAEEFLNVHCLSEYFKDETRWKNPYESIADKALKGKCDCKKMIPTTPEVKPKKPAVP
EAKKPEVEPLPSDEPFNRDILEKTIPFGVALALGSIAFLFLKKKTQAPVDLFSVINIPKG
DHDIPTLKSSNRYIPYVSDRYKGKTYIYMEGDSDSGHYYEDTTDITSSESEYEELDINDI
YPYKSPKYKTLIEVVLEPSGNNTPTSDTPSDTQNDIPSGDTPNNKLTDNEWNTLKDEFIS
QYIQSEQPNDVPNDYTSGNSSTNTNITTTSRHNVEEKPFIMSIHDRNLYTGEEYNYDMST
NSGNNDLYNGKNNLYSGQNNVYSGIDPTSDNRGPYSDKNDRISDNHHPYSGIDLINDTLS
GNAHIDIYDELLKRKENELFGTNHVKHTSTHSVAKHTNSDPIHNQLNLFHTWLDRHRDMC
EKWNTKEELLDKLNEQWNKDNNNSGNINPSGNTPPTSDIPSGKLSDIPSDNNIHSDIPYV
LNTDVSIQIDMNNPKTTNEFTYVDSNPNQVDDTYVDSNPDNSSMDTILEDLDKPFNEPYY
YDMYDDDIYYDVHDHDTSTVDTNAMDVPSKVQIEMDVNTKLVKEKYPISDVWDI
Download sequence
Identical sequences A0A2I0BPK7 C6KTF7
5833.PFF1580c-1 gi|46361274|emb|CAG25137.1| gi|86171918|ref|XP_966305.1| XP_966305.1.26446 PFF1580c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]