SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0BY60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0BY60
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-31
Family spliceosomal protein U5-15Kd 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0BY60
Sequence length 139
Comment (tr|A0A2I0BY60|A0A2I0BY60_PLAFO) Mitosis protein dim1 {ECO:0000313|EMBL:PKC48212.1} KW=Complete proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=CK202_1617 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLYHLHSGWDVDQAILSEEERLVCIRFGHDYDPDCMKMDELLFKVVEDIKNFCVIYLVDI
TEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIFRGA
RKGRGLVISPKDYSTKYKY
Download sequence
Identical sequences A0A060S1E4 A0A0L7K7B2 A0A0L7M7Y9 A0A2I0BY60 Q8I5A5
PFL1520w gi|124806392|ref|XP_001350710.1| gi|23496837|gb|AAN36390.1| PFHG_01024T0 XP_001350710.1.26446 XP_012764181.1.2076 5833.PFL1520w-1 PFDG_03986T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]