SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0BYP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0BYP3
Domain Number 1 Region: 43-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-50
Family Glutathione peroxidase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I0BYP3
Sequence length 205
Comment (tr|A0A2I0BYP3|A0A2I0BYP3_PLAFO) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} KW=Complete proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=CK202_1841 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMS
KFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDIC
TFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNG
EVVNYFSPKTNPLDLEKIIIQLLQK
Download sequence
Identical sequences A0A024VNQ3 A0A024WNL5 A0A024X5R4 A0A2I0BYP3 Q27742 Q8I5T2 W4IDL5 W7F4V6 W7JKN3
5833.PFL0595c-1 gi|124805752|ref|XP_001350528.1| gi|23496652|gb|AAN36208.1| PFL0595c XP_001350528.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]