SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0H809 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0H809
Domain Number 1 Region: 60-178
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000053
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I0H809
Sequence length 216
Comment (tr|A0A2I0H809|A0A2I0H809_9GAMM) Protein Syd {ECO:0000256|HAMAP-Rule:MF_01104, ECO:0000256|SAAS:SAAS00851392} OX=2058298 OS=Shewanella sp. 11B5. GN=CXF78_12600 OC=Shewanellaceae; Shewanella.
Sequence
MSCSSALDCFIKNYLKSYQDTLSEFPRYYPLGEDSICIQGTFNADTDDTVFWQPVKRDNV
ADFSNVEHALNIQLHQDIHAFYGQYFSAPLPFTASFGDGELLQAWNQDDFENLQQNVIGH
LIMKKKLKQPATWFIGVLGEGDEMLTVNNDDGSVWIEIPGEKQRTKLAESLTEFLESLSP
MIKPPSKPVEELPHTVDHPGIWQRIKTMWDYLLRKK
Download sequence
Identical sequences A0A2I0H809 Q085G3
gi|114562427|ref|YP_749940.1| 318167.Sfri_1249 WP_011636723.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]