SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0M700 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0M700
Domain Number 1 Region: 503-872
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.27e-127
Family Hect, E3 ligase catalytic domain 0.00000000364
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.3e-29
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000223
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 321-361
Classification Level Classification E-value
Superfamily WW domain 0.000000000000167
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 396-433
Classification Level Classification E-value
Superfamily WW domain 0.00000000000223
Family WW domain 0.00097
Further Details:      
 
Domain Number 6 Region: 173-203
Classification Level Classification E-value
Superfamily WW domain 0.0000000113
Family WW domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0M700
Sequence length 879
Comment (tr|A0A2I0M700|A0A2I0M700_COLLI) Neural cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase, transcript variant X4 {ECO:0000313|EMBL:PKK25456.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00006895 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
TRIVRVKVIAGIGLAKKDVLGASDPYVKVTVYDPANGVLTSVQTKTIKKSLNPKWNEELL
FRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPNMERPYTFKDFVLHPRSHK
SRVKGHLRLKMTYLPKSNGSEEETTEQAEELEPGWIILDQPDAASQPQQKQHSGWEERQD
ILGRTYYVNHEFRRTQWKRPTAQDNVAVADIGNVQLEAQHVFTHRRQISEDTENLDNRDS
PESWEIITEDEATAYSNQNVQIPLSQSNCDIQTHLAEELSTRLTTSGSSATGQSAAYTNH
SSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQDEKGRSYYIDHNSRTTTWIKPVVQ
IAMEPGQLSAAQSISVGRQQQATSSDSSQQSTHQQPEMEQGFLPKGWEVRHAPNGRPFFI
DHNTKTTTWEDPRLKISANLRRKTSLDPVDLGPLPPGWEERTHTDGRIFFINHNTKKTQW
EDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTILEDSYRRII
AVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQIN
PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLHDMESVDSEY
YNSLRWILENDPAELDLRFVVDEELFGQTHQHELKSGGSEIVVTNKNKRDYIHLVIQWRF
VSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHTKYKNGYNIN
HQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVEQWGTPEKL
PRAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A2I0M700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]