SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0MHK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0MHK8
Domain Number 1 Region: 313-412
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000732
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0MHK8
Sequence length 1170
Comment (tr|A0A2I0MHK8|A0A2I0MHK8_COLLI) Transient receptor potential cation channel, subfamily M, member 5 {ECO:0000313|EMBL:PKK29167.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00004629 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
MEEMETKVSSSDKEEVFKRELPYCTGEIDFTASGKKRGKFIKVPSTIHPGIIFEVMLNKW
KLPAPNLVVSLVGEEENFQMKPWLRDTLKKGLIKAAQSTGAWILTSALRVGVTRHLVQAV
RDHALASTSSKVRVIAIGITSLRKIQHSEILDNTKNESLVRYQSDDNIQGPLFSLEHNHS
HFILVDHITPDEPDGTTKLRLALEKHISEQRTGYGGTGSIEIPVLCLLVNGGPGTLERIC
SGLENSAPWLILAGSGGAADILAAFINDPQLITPEAVEKQVKEKFPAESFLWKDILQWTA
TIQNIISHQHLLTLHNFEQDGSEDLDTVILKALVKACKSHSQEAQEYLDELKLAVAWNRV
DIAKSEIFNGDVEWKSCDLEEVMMDALVNDKPEFVKLFIDNGANISEFLTYSRLQRLYCS
ISQKCLLYELLLKKHEESKLTLAGLTGQQHKEQKEICPLFTLGEVSRVLKDLLHDACKGF
YQDLRHGGKKRSDKVNMKRLPEPLDMNQKTENPWRDLFVWAVLQNRHKMANYFWAMGQEG
VASALAACKILKEMSRLETETEVARIMKEAKYEQLAVELFSECYHNSEERAFALLVRKNQ
YWSKTTCLQLATEADAKSFFAHDGVQAFLTRIWWGDMSTSTQILKLICGFWCPFLIYTNL
ISFSEEKQSKNEPEPFRELDSLATERTLFFSKEEDRGNGKLEKQNPSEKTAWATFMFTRW
RKFWSAPVTVFMGNVIMYFAFLFLFTYVLLLDFKPPPPEGPSAKEIILYFWVFTLVLEEI
RQSFYTDEDTNLMKKFKLYVEDNWNKCDMVTIFLFIIGVTCRMLNSTFQAGRTILAIDFM
VFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVTTQALLHPDDSRVE
WIFRRVLYRPYLQIFGQIPLDEIDTSRMYPRNCTFNPLQILQENSPSCPNSYANWLVILL
LVIFLLVTNVLLMNLLIAMFSYTFQVVQGNADIFWKIQRYNLIVEYHGRPALAPPFIIIN
HITLVVRRIFNKMEHKKEHLERDLPVGLDQKIITWELMQKEKYLGNLEQERKESNEERLK
ATSNKVDNLSKYFSGLKEQEKRFKVMEAQICYCTAVISSMAEVLTQTNLLCNQPASNYSC
VMNANTDTPLPGRKEECADQSKSDITFIDN
Download sequence
Identical sequences A0A2I0MHK8
XP_005499304.1.63277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]