SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0UHY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0UHY9
Domain Number 1 Region: 20-183
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-38
Family CRAL/TRIO domain 0.0025
Further Details:      
 
Domain Number 2 Region: 250-389
Classification Level Classification E-value
Superfamily PapD-like 2.59e-38
Family MSP-like 0.000000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I0UHY9
Sequence length 452
Comment (tr|A0A2I0UHY9|A0A2I0UHY9_LIMLA) Motile sperm domain-containing protein 2 {ECO:0000313|EMBL:PKU45663.1} OX=1758121 OS=Limosa lapponica baueri. GN=llap_4034 OC=Limosa.
Sequence
MLIFYDSNLKLDLTESVLPKWLFENGSLFLHGYDKEGYKLFWFRVKHHVRDPKQQLEKKK
LVAFWLEHYAKRDHGKPLTVVFDMAETGISHIDLDFVRFIVSCFTDYYPNFLTKIVIFEM
PWIMNAAFKIVKGWLGPDAISMLKFTNKNDVQEYISGEYLPPHMGGTDSFKYSYPPLVDD
DFQTPLCENGPITSEDEHESKEEIDADTKETGDLNEEQNLNHKKMNSVEQISKSEETDKT
EFKPKNAKKALTTFKGPLLHISPAEELYFGSKETGEKKCLIVLTNVTKNVVAFKVRTTAP
EKYRVKPSNSSCEPGTSLDIIVSLHGGFAASLQDRFLIMAAEMDQSSGAGVPELTQFWKE
VPRTKVMEHRLRCHVVESSKPSSLTLKENAFNIPAKTNEDLHVQLTRLLQINKRLQEQID
RCLWFQQLSVVLSLLSVTVVAFCFYLTYTQRS
Download sequence
Identical sequences A0A2I0UHY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]