SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2U1X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2U1X3
Domain Number 1 Region: 524-866
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.58e-111
Family Hect, E3 ligase catalytic domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 20-156
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-29
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 3 Region: 469-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000275
Family WW domain 0.00011
Further Details:      
 
Domain Number 4 Region: 182-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000153
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.00000000000057
Family WW domain 0.0019
Further Details:      
 
Domain Number 6 Region: 416-453
Classification Level Classification E-value
Superfamily WW domain 0.00000000000195
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2U1X3
Sequence length 867
Comment (tr|A0A2I2U1X3|A0A2I2U1X3_FELCA) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=NEDD4 OC=Felinae; Felis.
Sequence
MATCAVEVFGLPEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGIFTSVQ
TKTIKKTLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEEDNTEQTEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDSLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMDSNRAFPSPPASNNLDVQTHLAEE
LNARLTMCRNSATGQPVSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTAQAAVETGQLQPGQGATRPQPQVLPSDSAQQVTQPAEMEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDSSNDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFVIDEELFGQTHQHELKIGGS
EIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGL
GDVDVNDWREHTKYKNGYSVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTW
Download sequence
Identical sequences A0A2I2U1X3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]