SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2U2A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2U2A0
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 255-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000017
Family Centromere-binding 0.01
Further Details:      
 
Weak hits

Sequence:  A0A2I2U2A0
Domain Number - Region: 196-238
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0116
Family Cgl2762-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2U2A0
Sequence length 609
Comment (tr|A0A2I2U2A0|A0A2I2U2A0_FELCA) Pogo transposable element derived with KRAB domain {ECO:0000313|Ensembl:ENSFCAP00000026572} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=POGK OC=Felinae; Felis.
Sequence
MDSTAYTLNLTLKEEEEEEEIQSRELEDGPTDMQKVRICSEGGWVPALFDEVAIYFSDEE
WEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEGDEESQNSDEWQLQGGTLAE
NEETDVKPPDWAGPMNATPHFPQPQHLDGFGLRLPRDLTELPEWSEGYPFYMAMGFPGYD
LSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQ
LQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE
KGFKASLGWCRRMMRRYDLSLRHKVPVPQQLPEDLTEKLVTYQRSVLALRRAHDYQVAQM
GNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAAPKQRGMLILNGFRGHATDS
VKSSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
KPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEDEDDVLWEIESELPGGGEGPREC
DTESAPEGN
Download sequence
Identical sequences A0A2I2U2A0
ENSFCAP00000009781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]