SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2U7E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2U7E4
Domain Number 1 Region: 641-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.94e-56
Family Nucleotide and nucleoside kinases 0.0000000952
Further Details:      
 
Domain Number 2 Region: 377-474
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-32
Family PDZ domain 0.000077
Further Details:      
 
Domain Number 3 Region: 478-592,635-669
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-31
Family SH3-domain 0.0000716
Further Details:      
 
Domain Number 4 Region: 49-152
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-30
Family PDZ domain 0.000041
Further Details:      
 
Domain Number 5 Region: 156-250
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-27
Family PDZ domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2U7E4
Sequence length 833
Comment (tr|A0A2I2U7E4|A0A2I2U7E4_FELCA) Discs large MAGUK scaffold protein 2 {ECO:0000313|Ensembl:ENSFCAP00000028351} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=DLG2 OC=Felinae; Felis.
Sequence
MQRPSASRAENYQLLWDTIASLKQCEQAMQHAFIPASPAPIIVNTDTLDTIPYVNGTEIE
YEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRV
NEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVY
LKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKH
MLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSAPYPHYHLGLLPDSEMT
SHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGG
PADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIH
DLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINA
SDDEWWQARRVTLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGD
DGYGTKTLKHVSSNASDSESSYRGQEDFILSYEPVTRQEINYTRPVIILGPMKDRINDDL
ISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGT
SVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEEQAK
KTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL
Download sequence
Identical sequences A0A2I2U7E4 M3Y9R1
ENSMPUP00000008068 ENSMPUP00000008068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]