SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2U9M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2U9M3
Domain Number 1 Region: 60-189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000256
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 2 Region: 214-329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000301
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 601-742
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000878
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 4 Region: 502-609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000106
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  A0A2I2U9M3
Domain Number - Region: 425-506
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0132
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2U9M3
Sequence length 974
Comment (tr|A0A2I2U9M3|A0A2I2U9M3_FELCA) Spectrin repeat containing nuclear envelope family member 3 {ECO:0000313|Ensembl:ENSFCAP00000029168} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=SYNE3 OC=Felinae; Felis.
Sequence
MTQPPQEGFDRSVEEARQWMKAVQERLQVNDNTQGPRAALEARLRETEKICQLEPEGRVK
VDVVLRAAEGLLACCRGGQKPEILAQLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLL
ARDEFYRWFQKMMVVLELPVELQLGLKEKQWQLSHAQVLLHNVGNQAVLLDRLLEEAASL
FNRIGDPSVDEDAQKRMKAEYAAVKAKAQDRVDLLEQVTREHEHFQAGVDEFQLWLKAVV
EKVSSCLGRNCKLTTEGRLCALQDIAGDFPRGKESLRRLEEQAVGVIQNTSPLGAEKITE
ELEEMQKVLDKLRALWEEEEERLQGLLKSMGACEQQRRQLEAELGEFRKDLQRLAEEGLE
PAAKAGTEDELVDRWRLYSATRAALAAEEPRATRLQAQLKELIVYPHDLQPLSDSVVAAL
QEYQSMKGQSARLRNATGAELWQRFQRPLQDLQLWTALAQSLLDITASLPDLPSIHTFLP
QVEAALAESSRLKEQLMMLQLKKDLLRSVFGQDKATALLEQVASSVRDRDLLHNGLLQRK
SKLQSLLAQHQDFGAAFEPLRKKLSDLQGRVRAENGLQQDLPRKQTQLSRLQGLQEEGLD
LGAQMEAVRPLVQGNPTHQHKMEQLSADYQALQRSLEDLMDRCQQSVREHCTFSHQLLEL
RQWIAVVTQKLESHQEEAGPWDAQSREVEVERLLAEFPEKEAQLPLVEAYGRLVMKKSSP
EGAALVQEELEELVQSWQALKLLEEGLLSLIRNQQLQRTEVDSGKKTIFTNNIPKTGFLI
DPAEPLSGRHRRANLLREEGSREGYSQLLRDFEQWLEVENAKLVSIIAMRMAAARDLRAR
ETKLQELQARVPEGQRLFENLLHVGPARGSSDELEDLRYRWMLYKSKLKDSSHLLTQSSP
GEPTGFQKAPRWRGLGPLFRKVCCVALPLQLLFLLFLLLLFLLPVGEENRSCTLANNFAR
SFKFMLRYDGPPPT
Download sequence
Identical sequences A0A2I2U9M3
ENSFCAP00000011220 XP_003988000.1.62641 XP_006933142.1.62641 XP_019689158.1.62641 XP_019689159.1.62641 XP_019689160.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]