SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2UAP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UAP2
Domain Number 1 Region: 473-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.98e-60
Family Eukaryotic proteases 0.0000364
Further Details:      
 
Domain Number 2 Region: 381-475
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-33
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 204-287
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-33
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 4 Region: 112-202
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-31
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 5 Region: 295-378
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-30
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 6 Region: 34-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.35e-17
Family Hairpin loop containing domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UAP2
Sequence length 725
Comment (tr|A0A2I2UAP2|A0A2I2UAP2_FELCA) Macrophage stimulating 1 {ECO:0000313|Ensembl:ENSFCAP00000029539} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=MST1 OC=Felinae; Felis.
Sequence
MRLWWVTVQPPARRMGWFPLLLLLTQCSRVPGQRSPLNDFQVLRGTELQHLLHAAGPGPW
QEHVADAEECAGRCGPLLDCRAFHYNVSSHGCQLLPWTQYSPYTQLQRSGRCDLFQKKDY
VRTCVMDNGVKYRGTVAITTGGLPCQRWNHRFPNDHKYTPTLRNGLEENFCRNPDGDPGG
PWCYTTDPAVRFQTCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQRPHAHPFE
PGKFLDKDLDDNYCRNPDGSERPWCYTTDPKVEREFCDLPRCGSEAQPRHEATTLSCFRG
KGEGYRGTANTTAAGVPCQRWDAQNPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTS
RPGMRVAFCYQIRRCADDVRPEDCYHGVGEQYRGLVNRTRKGVPCQHWSTEMPHMPQFTP
TSAPHAHLEENFCRNPDRDSHGPWCYTTDPGTPFDYCALRRCDDDQPPSILEPPDQVVFE
KCGKRVTRLDQQRSKLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSS
CHMPLMGYEVWLGTLFQNPQPGEPGLQQVPVAKMVCGPSGSQLVLLKLERPVTLNQRVAL
ICLPPERYVVPPGTKCEIAGWGETKGTGNNKVLNVASLNVISNQECNIKHRGRIRESEMC
TEGLLAPVGACEGDYGGPLACFTHDCWVLEGIIIPNRVCARPRWPAIFMRVSVFTDWIHK
VMRLG
Download sequence
Identical sequences A0A2I2UAP2
ENSFCAP00000018093 XP_003982280.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]