SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I2UQH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UQH9
Domain Number 1 Region: 52-165
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 260-374
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 463-500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 173-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 219-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 424-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UQH9
Sequence length 647
Comment (tr|A0A2I2UQH9|A0A2I2UQH9_FELCA) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSFCAP00000034583} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=LRP3 OC=Felinae; Felis.
Sequence
MGIWNSHPGTLLSNSTKLMSDATGQSQRAAEMAVNIVLTGRLSSAVPALAACSGKLEQHT
ERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAP
PRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEF
RCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAE
RRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDP
RRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARA
RSAGHGFNATYQVKGYCLPWEQPCGSSSEGAAGDAGEQGCFSEPQRCDGWWHCASGRDEQ
GCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFET
WRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYR
AFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQNTPRKKTGTPVRMMMT
PTPHTMGSEMKLKTSRNAQKTNVSCFLGTEHFSSSRIYMQTEYLHLA
Download sequence
Identical sequences A0A2I2UQH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]