SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2UWM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2UWM0
Domain Number 1 Region: 11-51,182-213
Classification Level Classification E-value
Superfamily RING/U-box 3.89e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 223-277
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.44e-16
Family B-box zinc-binding domain 0.00085
Further Details:      
 
Weak hits

Sequence:  A0A2I2UWM0
Domain Number - Region: 169-178
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2UWM0
Sequence length 295
Comment (tr|A0A2I2UWM0|A0A2I2UWM0_FELCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSFCAP00000036940} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=TRIM52 OC=Felinae; Felis.
Sequence
MAGCATTPNPMQTLQEEAVCAICLDYFKDPVSIGCGHNFCRGCVTQLWGKEDEEDRDGEE
DGWEEDEDDDVEEATGGWDNSIREVLYQGSADEVFQDQEDELWVGDGGIRNWDNMDYVWD
QEEEEEEDQDYYLGSLRHDLRIDVYPEEEISEEYEDEEELYPDTHLPPPPPPPPPPPPPP
RQFICPQCRKSFKRRSFRPNLQLANMVQIIRQMSPTPYRGSRGNDQGICSKHQEALKLFC
EVDKEAICVVCRESRTHKQHSVVPMEEVVQEYKEKKMKKFVQPCIPSAATTLRGN
Download sequence
Identical sequences A0A2I2UWM0
XP_006927552.1.62641 ENSFCAP00000002799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]