SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2V1H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I2V1H2
Domain Number - Region: 61-93
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2V1H2
Sequence length 153
Comment (tr|A0A2I2V1H2|A0A2I2V1H2_FELCA) Proline rich membrane anchor 1 {ECO:0000313|Ensembl:ENSFCAP00000038438} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=PRIMA1 OC=Felinae; Felis.
Sequence
MLLRDLVLRRGCCWPSLLLHCALHPLWGFVQVTHGEPQKSCSKVTDSCQHICQCRPPPLL
PPPPPPPPPPRLLSAPAPNSTSCPTEESWWSGLVIVFAVCCASLVFLTVLVIICYKAIKR
KPLRKEENGTSVAEYPMTSSQSNKGVDVNSAVV
Download sequence
Identical sequences A0A2I2V1H2
ENSFCAP00000000335 XP_003987988.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]