SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2Y374 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2Y374
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.59e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0021
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-19
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2Y374
Sequence length 631
Comment (tr|A0A2I2Y374|A0A2I2Y374_GORGO) GIT ArfGAP 2 {ECO:0000313|Ensembl:ENSGGOP00000029334} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GIT2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKASRLEKQNSTPESDYDNTPNDMEPDGMGSSR
KGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRAAQENKHDS
YIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPGDPGSPTDV
QLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences A0A2I2Y374 A0A2I3REA3
NP_476511.1.87134 NP_476511.1.92137 ENSP00000447465 gi|17149832|ref|NP_476511.1| ENSP00000447465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]