SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YCP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YCP8
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily RNI-like 1.29e-31
Family Cyclin A/CDK2-associated p19, Skp2 0.0000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YCP8
Sequence length 210
Comment (tr|A0A2I2YCP8|A0A2I2YCP8_GORGO) S-phase kinase associated protein 2 {ECO:0000313|Ensembl:ENSGGOP00000032681} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SKP2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDQPLAEHFSTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV
QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQL
NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIGNKKNQEIWGIKCRLTLQKPSCL
Download sequence
Identical sequences A0A2I2YCP8 A0A2I3TNI2
NP_001230049.1.87134 NP_001230049.1.92137 ENSP00000443492 ENSP00000478031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]