SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YE05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YE05
Domain Number 1 Region: 61-291
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.27e-59
Family Ankyrin repeat 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YE05
Sequence length 386
Comment (tr|A0A2I2YE05|A0A2I2YE05_GORGO) Protein phosphatase 1 regulatory subunit 12B {ECO:0000313|Ensembl:ENSGGOP00000033163} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PPP1R12B OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEAVLFWPF
Download sequence
Identical sequences A0A2I2YE05 A0A2I3TSG2
gi|268607514|ref|NP_001161330.1| NP_001161330.1.87134 NP_001161330.1.92137 XP_016791368.1.37143 ENSP00000349206 ENSP00000349206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]