SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YPT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YPT4
Domain Number 1 Region: 137-337
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.87e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 22-111
Classification Level Classification E-value
Superfamily WWE domain 2.75e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YPT4
Sequence length 338
Comment (tr|A0A2I2YPT4|A0A2I2YPT4_GORGO) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PARP11 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MWEANPEMFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSS
EDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICEN
EAIPMPPHWENVNTQVPYQLIPLHSQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEF
FCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRVNGIHGAVFGKGTYFARD
AAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSK
DGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences A0A2I2YPT4
ENSGGOP00000012081 ENSGGOP00000012081 XP_004052570.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]