SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YTX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YTX3
Domain Number 1 Region: 200-545,624-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.12e-85
Family Myotubularin-like phosphatases 0.0000456
Further Details:      
 
Domain Number 2 Region: 43-186
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000119
Family GRAM domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YTX3
Sequence length 747
Comment (tr|A0A2I2YTX3|A0A2I2YTX3_GORGO) Myotubularin related protein 12 {ECO:0000313|Ensembl:ENSGGOP00000038177} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MTMR12 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLK
YVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGV
FDEKKKTLFGQLKKYPEKLIIHCKDLRVFQFCLRYTKEEEVKRIVSGIIHHTQAPKLLKR
LFLFSYATAAQNNTVTDPKNHTVMFDTLKDWCWELERTKGNMKYKAVSVNEGYKVCERLP
AYFVVPTPLPEENVQRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGILQIQKSFLDGI
YKTIHRPPYEVVKTEDLSSNFLSLQEIQTAYSKFKQLFLIDNSTEFWDTDIKWFSLLESS
SWLDIIRRCLKKAIEITECMEAQNMNVLLLEENASDLCCLISSLVQLMMDPHCRTRIGFQ
SLIQKEWVMGGHCFLDRCNHLRQNDKEEVPVFLLFLDCVWQLVHQHPPAFEFTETYLTVL
SDSLYIPIFSTFFFNSPHQKDTNMGREGQDTQSKPLNLLTVWDWSVQFEPKAQTLLKNPL
YVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLIN
SSDELQDNFREFYDSWHSKSTDYHGLLLPHIEGPEIKVWAQRYLRWIPEAQILGGGQVAT
MSKLLEMMEEVQSLQEKIDERHHSQQAPQAEGPCLLRNSARLSSLFPFALLQRHSSKPVL
PTSGWKALGDEDDLAKREDEFVDLGDV
Download sequence
Identical sequences A0A2I2YTX3
XP_004059039.1.27298 ENSGGOP00000009174 ENSGGOP00000009174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]