SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YYD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YYD0
Domain Number 1 Region: 54-215
Classification Level Classification E-value
Superfamily EF-hand 2.76e-41
Family Penta-EF-hand proteins 0.000000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YYD0
Sequence length 217
Comment (tr|A0A2I2YYD0|A0A2I2YYD0_GORGO) Grancalcin {ECO:0000313|Ensembl:ENSGGOP00000039997} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GCA OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILIDRYSGPAYSDTYSSTGDSVYTYFSA
VAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDYTGKMGFNAFKELWAA
LNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA
CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Download sequence
Identical sequences A0A2I2YYD0
ENSGGOP00000014678 XP_004032760.1.27298 ENSGGOP00000014678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]