SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YZ17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YZ17
Domain Number 1 Region: 494-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-81
Family Protein kinases, catalytic subunit 0.000000157
Further Details:      
 
Domain Number 2 Region: 62-183
Classification Level Classification E-value
Superfamily L domain-like 5.1e-23
Family Ngr ectodomain-like 0.000000556
Further Details:      
 
Domain Number 3 Region: 289-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000127
Family I set domains 0.00000372
Further Details:      
 
Domain Number 4 Region: 194-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000011
Family I set domains 0.00000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YZ17
Sequence length 796
Comment (tr|A0A2I2YZ17|A0A2I2YZ17_GORGO) Tyrosine-protein kinase receptor {ECO:0000256|RuleBase:RU000312} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NTRK1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQADWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
Download sequence
Identical sequences A0A2I2YZ17
XP_004027042.2.27298 ENSGGOP00000013487 ENSGGOP00000013487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]