SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2YZI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YZI5
Domain Number 1 Region: 9-168
Classification Level Classification E-value
Superfamily DTD-like 2.09e-43
Family DTD-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YZI5
Sequence length 168
Comment (tr|A0A2I2YZI5|A0A2I2YZI5_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000040133} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAEGSRIPQARALLQQCLHARLQIRPADGDVVAQWVEVQRGLVIYVCFFKGADKELLPKM
VNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS
QFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF
Download sequence
Identical sequences A0A2I2YZI5
ENSGGOP00000012599 XP_004055107.1.27298 ENSGGOP00000012599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]