SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2Z6Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2Z6Z5
Domain Number 1 Region: 120-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.95e-33
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 2 Region: 254-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-23
Family cAMP-binding domain 0.00000719
Further Details:      
 
Domain Number 3 Region: 19-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000837
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2Z6Z5
Sequence length 382
Comment (tr|A0A2I2Z6Z5|A0A2I2Z6Z5_GORGO) Protein kinase cAMP-dependent type II regulatory subunit alpha {ECO:0000313|Ensembl:ENSGGOP00000043029} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PRKAR2A OC=Catarrhini; Hominidae; Gorilla.
Sequence
XXXXXXXXXXXXXXXXXXVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKDGGN
QEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVTCLVMDVQAFERLLGPCMDIMKRNI
SHYEEQLVKMFGSSVDLGNLGQ
Download sequence
Identical sequences A0A2I2Z6Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]