SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2ZBT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2ZBT9
Domain Number 1 Region: 514-710
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-46
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 450-543
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 234-295
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 2-38
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000516
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  A0A2I2ZBT9
Domain Number - Region: 165-200
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00262
Family TFIIH p44 subunit cysteine-rich domain 0.069
Further Details:      
 
Domain Number - Region: 105-132
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0628
Family Di-heme elbow motif 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2ZBT9
Sequence length 721
Comment (tr|A0A2I2ZBT9|A0A2I2ZBT9_GORGO) Tripartite motif containing 67 {ECO:0000313|Ensembl:ENSGGOP00000044642} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TRIM67 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGGSAAGGLGGGAGGGGDHAD
KLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCP
QCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAA
TLCEQCDVLYCSACQLKCHPSRGPFAKHRLGAPSGGGGCKSPGGAGAGATGGSTARKFPT
CPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKA
KEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKM
VWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPK
VSAEFDLTLDSEPLLQAIHQLDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFTHS
PVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVL
QTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDN
HPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVL
LDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKLSG
N
Download sequence
Identical sequences A0A2I2ZBT9
ENSP00000400163 ENSP00000400163 NP_001287818.1.87134 NP_001287818.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]