SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2ZFA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2ZFA1
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I2ZFA1
Sequence length 214
Comment (tr|A0A2I2ZFA1|A0A2I2ZFA1_GORGO) Neurogenin 3 {ECO:0000313|Ensembl:ENSGGOP00000045960} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NEUROG3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALESPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLLGASSSACLSPGTLAFSDFL
Download sequence
Identical sequences A0A2I2ZFA1
ENSGGOP00000002715 ENSGGOP00000002715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]