SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2ZMC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2ZMC7
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily t-snare proteins 9.42e-28
Family t-snare proteins 0.00000407
Further Details:      
 
Domain Number 2 Region: 125-184
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000126
Family SNARE fusion complex 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2ZMC7
Sequence length 217
Comment (tr|A0A2I2ZMC7|A0A2I2ZMC7_GORGO) Vesicle transport through interaction with t-SNAREs 1A {ECO:0000313|Ensembl:ENSGGOP00000048174} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=VTI1A OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH
Download sequence
Identical sequences A0A2I2ZMC7 H2RC26 Q96AJ9
ENSP00000376792 9598.ENSPTRP00000056669 9606.ENSP00000376792 ENSPTRP00000056669 ENSGGOP00000010302 gi|113374156|ref|NP_660207.2| ENSPTRP00000005198 ENSP00000376792 NP_660207.2.87134 NP_660207.2.92137 XP_001147118.1.37143 XP_003825639.1.60992 XP_004050158.1.27298 ENSGGOP00000010302 ENSP00000376792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]