SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I2ZV28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2ZV28
Domain Number 1 Region: 41-764
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.05e-271
Family Motor proteins 5.97e-16
Further Details:      
 
Domain Number 2 Region: 765-890
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.71e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 885-1001
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.55e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1171-1278
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.05e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 989-1080
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000196
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1443-1556
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000222
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1278-1379
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000262
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1688-1789
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000577
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I2ZV28
Sequence length 1889
Comment (tr|A0A2I2ZV28|A0A2I2ZV28_GORGO) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSGGOP00000051007} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MYH9 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQSLRWCRPLVMKKTKGWKELGELASVTKEVGIGDPSLLPTYSGLFCVVINPYKNLPIYS
EEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYL
AYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVG
ANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIP
GQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAA
QKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVL
RINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEE
YQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQG
THPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSEL
WKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRC
IIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPK
GFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCR
GYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKE
EELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQ
ELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEA
KLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITD
LEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALAR
VEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDT
LDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRV
KANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTEL
ADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKL
KQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQ
KDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLA
EEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMS
SKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFER
DLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANK
NRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAA
AERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDR
LKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITA
LEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTR
LKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVP
RRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences A0A2I2ZV28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]