SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3FTG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3FTG5
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-24
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.3e-20
Family Platelet-derived growth factor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3FTG5
Sequence length 370
Comment (tr|A0A2I3FTG5|A0A2I3FTG5_NOMLE) Platelet derived growth factor D {ECO:0000313|Ensembl:ENSNLEP00000024925} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PDGFD OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MHRLIFVYTLVCANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDVLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences A0A2I3FTG5
XP_003253107.1.23891 ENSNLEP00000008772 ENSNLEP00000008772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]