SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3FTK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3FTK3
Domain Number 1 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 232-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 291-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-20
Family KRAB domain (Kruppel-associated box) 0.00048
Further Details:      
 
Domain Number 9 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 582-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 11 Region: 503-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000533
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 91-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000973
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3FTK3
Sequence length 641
Comment (tr|A0A2I3FTK3|A0A2I3FTK3_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000024952} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ZNF709 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEKNIEDHKNQGR
KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKDYMCHSSLNRH
MRSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWP
SSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFR
NHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHER
IHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTG
NGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPH
ECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQ
CGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKA
FSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAFSCS
RSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
Download sequence
Identical sequences A0A2I3FTK3 A0A2I3RJ81 Q8N972
gi|22749235|ref|NP_689814.1| ENSP00000380840 ENSP00000404127 9598.ENSPTRP00000017976 9606.ENSP00000380840 ENSP00000380840 ENSP00000404127 ENSP00000380840 ENSP00000404127 NP_689814.1.87134 NP_689814.1.92137 XP_003275832.1.23891 XP_016802422.1.37143 XP_524120.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]