SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3FVD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3FVD2
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily UBA-like 1.32e-28
Family UBA domain 0.0000896
Further Details:      
 
Domain Number 2 Region: 167-259
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-16
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3FVD2
Sequence length 450
Comment (tr|A0A2I3FVD2|A0A2I3FVD2_NOMLE) Ubiquitin specific peptidase 25 {ECO:0000313|Ensembl:ENSNLEP00000025183} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=USP25 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQ
NNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPF
LPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEP
PKLPSYSTHELCERFARIMLSLSRTPADGR
Download sequence
Identical sequences A0A2I3FVD2 Q96B65
ENSP00000299574 ENSP00000299574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]