SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3FZG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3FZG4
Domain Number 1 Region: 10-180,282-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-48
Family FAD-linked reductases, N-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3FZG4
Sequence length 486
Comment (tr|A0A2I3FZG4|A0A2I3FZG4_NOMLE) Kynurenine 3-hydroxylase {ECO:0000256|HAMAP-Rule:MF_03018} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=KMO OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVANFTRGRSINLALSH
RGRQALKAVDLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKRLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSLCLPAFSRLRVPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLMHYMSPRPFLCLRRPWNWIAHFRNTTCFPAKAMDSLEQI
SSLISR
Download sequence
Identical sequences A0A2I3FZG4
ENSNLEP00000004524 ENSNLEP00000004524 XP_003267365.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]