SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3G9R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3G9R5
Domain Number 1 Region: 208-418
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-60
Family DBL homology domain (DH-domain) 0.0000000666
Further Details:      
 
Domain Number 2 Region: 403-561
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-46
Family Pleckstrin-homology domain (PH domain) 0.00000245
Further Details:      
 
Domain Number 3 Region: 111-229
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-22
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3G9R5
Sequence length 621
Comment (tr|A0A2I3G9R5|A0A2I3G9R5_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000028033} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ARHGEF4 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRPDRQQALDAVVRNYDCHSEADLRQRNDVIYCSLPRTTRGIVQREDKLEVLVSLREVWG
QRGGRDGTCTGAMPDGALDTAVRADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELI
SDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLR
VNQDEPADDEAPRAGDSGAEDGGAEVQSSKDQMRTNVINEILSTERDYIKHLRDICEGYV
RQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQMFNRERPHLSELGACFLEHQAD
FQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYP
LQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGE
DLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDG
LEVVDLEDGKDRDLHVSIKNAFRLHCGATGDSHLLCTRKPEQKQRWLKAFAREREQVQVQ
LDQETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSSRPQQQVLVLA
EPRRKPSTFWHSISRLAPFRK
Download sequence
Identical sequences A0A2I3G9R5
ENSNLEP00000013053 XP_012353266.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]