SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GC09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GC09
Domain Number 1 Region: 32-112
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.28e-28
Family MHC antigen-recognition domain 0.00011
Further Details:      
 
Domain Number 2 Region: 116-210
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-24
Family C1 set domains (antibody constant domain-like) 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GC09
Sequence length 260
Comment (tr|A0A2I3GC09|A0A2I3GC09_NOMLE) Major histocompatibility complex, class II, DP alpha 1 {ECO:0000313|Ensembl:ENSNLEP00000028864} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=HLA-DPA1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MCPEDRMFHIRAMMLRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNIMIQRSNHTQAASDPPEV
TMFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TILILKAIRSGRDPRAQGPL
Download sequence
Identical sequences A0A2I3GC09
ENSNLEP00000008272 ENSNLEP00000008272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]