SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GC18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GC18
Domain Number 1 Region: 298-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.14e-86
Family Eukaryotic proteases 0.000000000578
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-32
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 3 Region: 213-301
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-31
Family Kringle modules 0.00000699
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.82e-20
Family Fibronectin type I module 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GC18
Sequence length 562
Comment (tr|A0A2I3GC18|A0A2I3GC18_NOMLE) Plasminogen activator {ECO:0000256|PIRNR:PIRNR001145} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PLAT OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MNAMKRGLCCVLLLCGAVFASPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTTATCYEDQGISYRGMWSTAESGAECTNWNSSALAQKPYSGRRPDAVRLGLGNHNYCR
NPDGDSKPWCYVFKAGKYSSEFCSTPACSKGNSDCYFGNGLAYRGTHSLTELGASCLPWN
SMILIGKVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHKRLPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRAVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNFLDWIHDNMRP
Download sequence
Identical sequences A0A2I3GC18
ENSNLEP00000015584 XP_003269679.1.23891 ENSNLEP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]