SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GD52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GD52
Domain Number 1 Region: 40-153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 248-362
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 451-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 161-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 207-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GD52
Sequence length 767
Comment (tr|A0A2I3GD52|A0A2I3GD52_NOMLE) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSNLEP00000029236} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LRP3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEKRAAAGLEGAPGARAQLAVVCLGEWAGLSRPPLLTAACSGKLEQHTERRGVIYSPAWP
LNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCGSA
IPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPW
QCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDCGDG
SDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLG
YDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQ
VKGYCLPWEQPCGSSSDSDGGSPGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPC
EGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDG
SDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAE
FVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRR
LGRLWNRLFHRPRAPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLMDTGSTRVA
GDGPPSAPGRAPEVGPSGPPLPSGLRDPECRPVDKDRKVCREPLADSPAPADAPREPCSA
QDPHPQASTASSTLGPHSPEPLGVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences A0A2I3GD52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]