SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GEG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GEG1
Domain Number 1 Region: 56-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 264-378
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000123
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 467-504
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 177-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 223-262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 428-465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GEG1
Sequence length 701
Comment (tr|A0A2I3GEG1|A0A2I3GEG1_NOMLE) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSNLEP00000029687} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LRP3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALGKWAGLSRPPLLTAACSGKL
EQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLG
PAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQ
ADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRC
LPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVD
TQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAY
HARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGSPGDQGCFSEPQRCDGWWHCASG
RDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLC
IFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRT
QEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQNTPRKKMGTPVR
MMMTPTPQTIGSEMKLKTSRKAQKTKYATGMRRFTWGRGSRNTNGAGPPAVCTPDPWGSG
EFSFLPWELRPEGQLHPLHPLLATAQCVGGQFMGQAVGQFC
Download sequence
Identical sequences A0A2I3GEG1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]