SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GEI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GEI2
Domain Number 1 Region: 352-444
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-25
Family DEATH domain, DD 0.00000702
Further Details:      
 
Domain Number 2 Region: 101-144
Classification Level Classification E-value
Superfamily TNF receptor-like 5.14e-17
Family TNF receptor-like 0.0000669
Further Details:      
 
Domain Number 3 Region: 43-100
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000037
Family TNF receptor-like 0.0000149
Further Details:      
 
Domain Number 4 Region: 145-198
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000883
Family TNF receptor-like 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GEI2
Sequence length 455
Comment (tr|A0A2I3GEI2|A0A2I3GEI2_NOMLE) TNF receptor superfamily member 1A {ECO:0000313|Ensembl:ENSNLEP00000029736} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TNFRSF1A OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MGLSTVPDLLLPLVLLELLVGIHPSGVIGLVPHLRDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECEGGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKSTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPTPSFSPTPGFTPTLSFNPMLSSTFTSSFTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPTPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLAAWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPEPGLLR
Download sequence
Identical sequences A0A2I3GEI2
ENSNLEP00000004404 XP_003273764.1.23891 ENSNLEP00000004404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]