SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GGI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GGI8
Domain Number 1 Region: 254-337
Classification Level Classification E-value
Superfamily E set domains 4.86e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  A0A2I3GGI8
Domain Number - Region: 344-394
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00174
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GGI8
Sequence length 523
Comment (tr|A0A2I3GGI8|A0A2I3GGI8_NOMLE) Early B-cell factor 1 {ECO:0000313|Ensembl:ENSNLEP00000030416} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=EBF1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPH
AIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPG
DPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTS
VHAGMMGVNSFSGQLAVNVSEASQATNQVVPSSPTMASSTSLPSNCSSSSGIFSFSPANM
VSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences A0A1D5R3D0 A0A2I2Y7X2 A0A2I3GGI8 A0A2I3M3Y4 A0A2I3SY81 A0A2J8X6T5 A0A2K5EVN9 A0A2K5NLD5 A0A2K5RVJ0 A0A2K5WH64 A0A2K6BUH5 A0A2K6FKI6 A0A2K6NZG7 E5RFQ1 Q3UTW6
ENSP00000428020 ENSP00000428020 NP_001277639.1.92730 XP_021067661.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]