SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GGW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GGW8
Domain Number 1 Region: 27-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.68e-30
Family MHC antigen-recognition domain 0.00000844
Further Details:      
 
Domain Number 2 Region: 113-207
Classification Level Classification E-value
Superfamily Immunoglobulin 7e-24
Family C1 set domains (antibody constant domain-like) 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GGW8
Sequence length 255
Comment (tr|A0A2I3GGW8|A0A2I3GGW8_NOMLE) Major histocompatibility complex, class II, DQ alpha 1 {ECO:0000313|Ensembl:ENSNLEP00000030543} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=HLA-DQA1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MILNKALMLGALALTTVMSPCGGEDIVADHVASCGVNLYQSYGLSGQYTHEFDGDEQFYV
DLGRKETAWRWPELSNFGGFDPQGALRNLAVVKHNLDIMIKRFNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLGEPLLKHWEPEIPAPMSELTETVVCALGLSAGLVGIVVGTVFII
QGLRSVGASRHQGPL
Download sequence
Identical sequences A0A2I3GGW8
ENSNLEP00000008165 ENSNLEP00000008165 XP_003272199.1.23891 XP_004087147.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]