SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GRY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GRY3
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-43
Family Dual specificity phosphatase-like 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GRY3
Sequence length 173
Comment (tr|A0A2I3GRY3|A0A2I3GRY3_NOMLE) Protein tyrosine phosphatase type IVA, member 1 {ECO:0000313|Ensembl:ENSNLEP00000034017} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PTP4A1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTALVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Download sequence
Identical sequences A0A2I3GRY3 A0A2K6F4L2 H2PJH1
XP_003276039.1.23891 XP_004696385.1.18182 XP_007955114.1.48129 XP_012358293.1.23891 XP_012358294.1.23891 XP_012505733.1.63892 XP_021505510.1.76796 ENSPPYP00000018734 ENSPPYP00000018734 ENSETEP00000006648 9600.ENSPPYP00000018734 ENSNLEP00000000527 ENSNLEP00000000527 ENSETEP00000006648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]