SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3GT76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3GT76
Domain Number 1 Region: 170-268
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 50-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000738
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 3 Region: 122-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000485
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3GT76
Sequence length 302
Comment (tr|A0A2I3GT76|A0A2I3GT76_NOMLE) Kazal type serine peptidase inhibitor domain 1 {ECO:0000313|Ensembl:ENSNLEP00000034457} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=KAZALD1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPPPPAAALSLPVLLLLLVVLTPPPTGARPSPGPDYLRRGWLRLLAEGEGCAPCRPEECA
APRGCLAGWVRDACGCCWECANLEGQLCDLDPSALFYGHCGEQLECRLDTGGDLSRGEVP
EPLCACRSQSPLCGSDGHTYAQICRLQEAARARPYANLTVAHPGPCESGPQIVSHPYDTW
NVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQA
VRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPEEEAESEESDD
YY
Download sequence
Identical sequences A0A2I3GT76
XP_012361077.1.23891 ENSNLEP00000018039 ENSNLEP00000018039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]