SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3H3A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3H3A0
Domain Number 1 Region: 111-220
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-19
Family V set domains (antibody variable domain-like) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3H3A0
Sequence length 577
Comment (tr|A0A2I3H3A0|A0A2I3H3A0_NOMLE) Fc fragment of IgA and IgM receptor {ECO:0000313|Ensembl:ENSNLEP00000038069} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=FCAMR OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDGEATVKPREQKAVVRRGTEVDYSRLIAGTLPQSHVTNRRPGWKMPLFLILCLLQGSSF
ALPQKRPHPRWLWEGSLPSRTHLRAMGTLTPSSPLCWREESSFAAPNALKGSRLVSGEPG
GAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNHYTHHRYRDRVALTDFPQRGL
FVVRLSQLSPDDIGCYLCGIGSENNMLFLSMNLTISAGPSSTLPTATPAAGELTMRSYGT
ASPVANRWTPGTTQTLGQGTARDTVASTPGTSMTTASAEGRQTPGATRPEAPGTGSWVEG
SVKVPAPIPESPASKSRSMSNTTEGVWEGTISLVTNRVRASKDRREMTTTKADRPREDTE
GVRIALDAAKKVPGTIRPPALVSETLAWEILPQATPVSKQQSLGSIGETTPAAGMWTLGT
PAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATEDRGPQATLSQAPAVGPWRPPGKE
SSVKSTFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLRRRRTSQEAERVTLIQMTHFL
EVNPQADQLPHVERKMLQDDSLPAGASLTVPERNAGP
Download sequence
Identical sequences A0A2I3H3A0
ENSNLEP00000001110 ENSNLEP00000001110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]