SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3H3L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3H3L6
Domain Number 1 Region: 432-567
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-31
Family Netrin-like domain (NTR/C345C module) 0.033
Further Details:      
 
Domain Number 2 Region: 209-304
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 385-437
Classification Level Classification E-value
Superfamily BPTI-like 9.65e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 324-380
Classification Level Classification E-value
Superfamily BPTI-like 7.09e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 123-172
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 37-88
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3H3L6
Sequence length 576
Comment (tr|A0A2I3H3L6|A0A2I3H3L6_NOMLE) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 {ECO:0000313|Ensembl:ENSNLEP00000038258} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=WFIKKN2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MWALRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQS
TCRRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQG
SECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAIVTCRYHFT
WPNTSPPPPETTIHPTTASPETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPE
ITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNAAGVLRADF
PLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGDEQTRWHFDAQANNCLTFTFGH
CHRNLNHFETYEACMLACMNGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGR
ALVTVDEVLKDEKMGLKFLGREPLEVTLLHVDWACPCPNVSVSETPLIIMGEVEGGMAML
RPDSFVGASSARRVRKLREVMHKKTCDVLKEFLGLH
Download sequence
Identical sequences A0A2I3H3L6
XP_003272312.1.23891 ENSNLEP00000009618 ENSNLEP00000009618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]