SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3H6W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3H6W0
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000157
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3H6W0
Sequence length 215
Comment (tr|A0A2I3H6W0|A0A2I3H6W0_NOMLE) Sodium voltage-gated channel beta subunit 3 {ECO:0000313|Ensembl:ENSNLEP00000039207} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SCN3B OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPAFNRLLPPASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE
Download sequence
Identical sequences A0A2I3H6W0
ENSNLEP00000009043 ENSNLEP00000009043 XP_003253356.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]