SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3HDR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3HDR9
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.01e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000664
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-35
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-32
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.03e-20
Family First domain of FERM 0.0027
Further Details:      
 
Domain Number 5 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-20
Family PDZ domain 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3HDR9
Sequence length 913
Comment (tr|A0A2I3HDR9|A0A2I3HDR9_NOMLE) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PTPN3 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMAYN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHSGYLSDSQFIPDQ
NDDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGTL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCAEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMDHGSFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Download sequence
Identical sequences A0A2I3HDR9
ENSNLEP00000021176 ENSNLEP00000021176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]