SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I3HG51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3HG51
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-32
Family cAMP-binding domain 0.000000496
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-32
Family cAMP-binding domain 0.000000495
Further Details:      
 
Domain Number 3 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3HG51
Sequence length 381
Comment (tr|A0A2I3HG51|A0A2I3HG51_NOMLE) Protein kinase cAMP-dependent type I regulatory subunit alpha {ECO:0000313|Ensembl:ENSNLEP00000042441} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PRKAR1A OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A2I3HG51 A0A2J8V090 B2R5T5 H2R3M7 P10644 Q5REL1
ENSP00000351410 ENSP00000376475 ENSP00000445625 ENSP00000464977 ENSP00000466459 ENSP00000351410 ENSP00000376475 ENSP00000445625 ENSP00000464977 ENSP00000466459 ENSPTRP00000045750 ENSNLEP00000002549 ENSNLEP00000002549 ENSP00000351410 ENSPPYP00000010056 NP_001263218.1.87134 NP_001263218.1.92137 NP_001265362.1.87134 NP_001265362.1.92137 NP_002725.1.87134 NP_002725.1.92137 NP_997636.1.87134 NP_997636.1.92137 NP_997637.1.87134 NP_997637.1.92137 XP_003276124.1.23891 XP_003276125.1.23891 XP_003276126.1.23891 XP_003315745.1.37143 XP_003315746.1.37143 XP_003808984.1.60992 XP_003808985.1.60992 XP_003808986.1.60992 XP_008959336.1.60992 XP_009234925.1.23681 XP_009234926.1.23681 XP_009234927.1.23681 XP_009431413.1.37143 XP_009431414.1.37143 XP_011523285.1.92137 XP_011523286.1.92137 XP_011523287.1.92137 XP_012358110.1.23891 XP_511647.3.37143 9606.ENSP00000351410 gi|4506063|ref|NP_002725.1| gi|47132581|ref|NP_997636.1| gi|47132583|ref|NP_997637.1| ENSPPYP00000010056 ENSPTRP00000045750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]